SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3JI64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3JI64
Domain Number 1 Region: 447-574
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000779
Family Protein kinases, catalytic subunit 0.022
Further Details:      
 
Weak hits

Sequence:  A0A2H3JI64
Domain Number - Region: 304-395
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0732
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3JI64
Sequence length 923
Comment (tr|A0A2H3JI64|A0A2H3JI64_WOLCO) Uncharacterized protein {ECO:0000313|EMBL:PCH41876.1} KW=Complete proteome; Reference proteome OX=742152 OS=Wolfiporia cocos (strain MD-104) (Brown rot fungus). GN=WOLCODRAFT_163397 OC=Agaricomycetes; Polyporales; Wolfiporia.
Sequence
MASSSRSAPATRARPLSFDFTDRTSGVDRRKAWLNVPTAEEARWGQTGEERRKRNSDLAK
DAWQLMAKRTPLTMDAFLHEFLPAPQRSQDKPRRTRLFKGVSECCNAEEILKQLATALND
ASDVHSLCPGLRFHLKSYPGGGDSTRPPVVCCLANSTAAPLRHSEQGVDLGFAELFIDAH
PDPVTDFVDCVHPRWRISRGLIAQSEEKEASLRIGETVTCAAEIFGRQHRRFCFSVSVSG
TLYRIFHWDRAGVSVTRAHDLHEDPGYLCEFLWRFAHASDEGRGFDPTVRPATEEQEVSF
ERVVRRHAQEQILCEDNEALADAMEEHYVPGRVAQVAVVDGDDQQVYWYTVSRPVVSPYN
LWNKGTRGWWAVSEDGSITFLKEIWRVGTEYDEGRTLDHLQRANVRHVPVALHYGNVWET
PNRAMDAGYSEYESETEFDELTKGTAHYRIATDTVGYDLKRVTGAKDLLFATRDILEALQ
DAQKWPKIHRDVSIGNILLVVDRKSKRCRGCLIDWEYSADLDAEGKPYDDAHGTKFQFGT
PSFMSVDRLNCSGPHSIEDDMESLLYVVLYCALRDSKTTTPAADAREACRALFSRPQRTK
QGRWVCPPAKAKNQQDRRITKGVRFRSNALNHWLDTMLKLNSSRDTWTYQRVAHEWDRIL
AMWDELQAGGAKEEPSTGPGTAPPPRADTCQEVNAKADFDERRDNRDEQKRKAPHDPEEA
KGRHATKRPKVELVVKFTTNKRKAQNLPVVEYVKDGGGGRVKEEASLLQRRQEEEEAKLP
KDILKDKLAATRAWVEAQQACIESMEQKADIWQNGSMDTEKVDCKPSEGGGKRKVDAGPP
DQDDGERVAKRVKETKSLQALSGTNKARGSGEGSVDQRQDSRAGAKKFELHPPLTRQQEP
RFAVSTPKVEGLRVTRSMTRALS
Download sequence
Identical sequences A0A2H3JI64
jgi|Wolco1|163397|estExt_Genemark1.C_5_t10042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]