SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3TXR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3TXR9
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.68e-85
Family Capz alpha-1 subunit 0.00000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3TXR9
Sequence length 273
Comment (tr|A0A2H3TXR9|A0A2H3TXR9_FUSOX) Probable actin-capping protein alpha-2 chain {ECO:0000313|EMBL:SCO86729.1} KW=Complete proteome; Reference proteome OX=5507 OS=Fusarium oxysporum (Fusarium vascular wilt). GN=FRV6_10856 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSDLETVSAFVEGAPPGELADVIADIKSLTLETSPDIISNLGPAFEKYNEEQFVTVKLPG
SSQPVIISSHNSLGDGRYYDVESSSSFAFDHTTQKASAVQSHVLEGAQADLVKSTLKSIG
PYVDEHFANAAHGVYPIESDSKIAIVIVGNKYSPNNFWNGRWRSLYVLDPSSGALEGSLK
VDVHYYEDGNVRLLTNKPVSSTISSVNGASIVREISTTERKYQEELNKGFVSLSEGAFKG
LRRQLPVTRQKIEWDRVTSYRLGQDIGGGSSRR
Download sequence
Identical sequences A0A2H3TXR9 F9FXE6 N4TZ88 W9PCS9 X0D709 X0HEA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]