SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4VY23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4VY23
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily YcfC-like 3.66e-73
Family YcfC-like 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H4VY23
Sequence length 207
Comment (tr|A0A2H4VY23|A0A2H4VY23_9PSED) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} KW=Complete proteome; Reference proteome OX=1206777 OS=Pseudomonas sp. Lz4W. GN=B195_007655 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNPTQEQLIALGGVFLAAVLVDKIAKTGQVSEADLSCMLGSLLIRDPKDTLEVYGGDDIN
LREGYRALIGALERDPNTLQREPLRYALSMLGLERQLAKREDMLELIGKRLPQIQSQVEH
FGPAHENVVAACGALYQDTLSTLRQRIQVHGDMRNLQQPNNAAKIRALLLAGIRSARLWR
QLGGHRWQLVISRRKLLKELYPMLRGN
Download sequence
Identical sequences A0A109RAC2 A0A2H4VY23
WP_003447017.1.11658 WP_003447017.1.77201 WP_003447017.1.99720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]