SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5BX37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H5BX37
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily Coronavirus RNA-binding domain 6.93e-48
Family Coronavirus RNA-binding domain 0.00027
Further Details:      
 
Domain Number 2 Region: 214-320
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 1.02e-33
Family Coronavirus nucleocapsid protein 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H5BX37
Sequence length 358
Comment (tr|A0A2H5BX37|A0A2H5BX37_9ALPC) Nucleoprotein {ECO:0000256|SAAS:SAAS00869216} OX=12663 OS=Feline coronavirus. GN=N OC=Nidovirales; Coronaviridae; Coronavirinae; Alphacoronavirus.
Sequence
DEPSKRRVRSNSRGRKSGNIPLSYSNPITLEPGSNFWNVCPRDFVPKGIGNKDQQIGYWN
RHERYRIVKGQRKELPERWFFYFLGTGPHADAKFKDKIDGVFWVARDGAMNKPTTLGTRG
TNNESKPLKFDGKTPPQFQLEVNRSRNNSRSGYQSRSVSRNRSQSRGRQHSNNQSNNVED
TIVAVLEKLGVTDKQRSRPKSKDRSDSKPRDTIPNNANKHTWKKTAGKGDVTNFYGARSA
SANFGDSDLVANGNAAKCYPQIAECVPSVSSMLFGSQWSAEEAGDQVKVTLTHTYYLPKD
DAKTSQFLEQIDAYKRPSQVAKDQRQRKSRSKSADKKPEELSVTLVEAYTDVFDDTQV
Download sequence
Identical sequences A0A2H5BX37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]