SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5SPF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2H5SPF0
Domain Number - Region: 23-98
Classification Level Classification E-value
Superfamily Staphylokinase/streptokinase 0.0275
Family Staphylokinase/streptokinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H5SPF0
Sequence length 165
Comment (tr|A0A2H5SPF0|A0A2H5SPF0_RHIID) Uncharacterized protein {ECO:0000313|EMBL:GBC32194.1} OX=747089 OS=43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices). GN=RIR_1736000 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MANEPTNENFSHVTTAIISDNFSTQQMIPRQLVQDHQIAQDVISHFFYKPPNDYQIYDIS
YREIQISFELVSELLDSNNNTSYSVQNHVQSNNLHEFYFLKAEEKKCYKVTCVLIPHSSI
VEYLNKNIHGVEFNHNEQQQEIYVEFSRELKENLEYYLKQFLASK
Download sequence
Identical sequences A0A015K7G8 A0A2H5SPF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]