SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5XEB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H5XEB4
Domain Number 1 Region: 96-138
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0000889
Family E6 C-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H5XEB4
Sequence length 162
Comment (tr|A0A2H5XEB4|A0A2H5XEB4_9BACT) Uncharacterized protein {ECO:0000313|EMBL:GBC99515.1} OX=2035412 OS=bacterium HR17. GN=HRbin17_02040 OC=Bacteria.
Sequence
MGDAAPRFIADVMLGKLARWLRILGYDVAYDPRADDEQLVRQAVAEGRTLLTKDRRLVER
WRKKLRQHGYLLLASDDWREQLRQTVHHFRLDTHNHRLTRCPDCNGVLEAVDKEAVRYRV
PFFVFAHYDRFARCQRCGKVYWAGSHYERISTALDELLRETP
Download sequence
Identical sequences A0A2H5XEB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]