SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0FW55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0FW55
Domain Number 1 Region: 6-166
Classification Level Classification E-value
Superfamily MtlR-like 1.24e-54
Family MtlR-like 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I0FW55
Sequence length 174
Comment (tr|A0A2I0FW55|A0A2I0FW55_9GAMM) MltR family transcriptional regulator {ECO:0000313|EMBL:PKH23663.1} OX=2025587 OS=Enterobacterales bacterium CwR94. GN=CIG19_09540 OC=unclassified Enterobacterales.
Sequence
MEEKRAFENQVLERLNTGRNVRAFLMNAVELLAEAVDTLVVQVFRKDDYAVKYAVEPLLL
GDGPLGDLSVRLKLIYGLGVLSRNEYEDAELLLALREALDDDPSDFRFTDDEVLGPLGEL
HCVAVFPPAPVYSGEDAALRAMQQHRYLQMVRSTLVLSLTEYISHIRLRKVFQK
Download sequence
Identical sequences A0A2I0FW55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]