SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I0KJ03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0KJ03
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.55e-23
Family Capz beta-1 subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I0KJ03
Sequence length 125
Comment (tr|A0A2I0KJ03|A0A2I0KJ03_PUNGR) Uncharacterized protein {ECO:0000313|EMBL:PKI68429.1} KW=Complete proteome OX=22663 OS=Punica granatum (Pomegranate). GN=CRG98_011226 OC=Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica.
Sequence
MWEDDNEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPDEDGTAHYCLTSTVM
LSLTTDNESSGTFSLSGSIRRQMNMDLSVADGHLCNMGRMIEEMESKLRNSLDQPSRQIN
TVSCE
Download sequence
Identical sequences A0A2I0KJ03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]