SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I0M396 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0M396
Domain Number 1 Region: 7-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.14e-98
Family Capz beta-1 subunit 0.000000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I0M396
Sequence length 282
Comment (tr|A0A2I0M396|A0A2I0M396_COLLI) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:PKK24149.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00006202 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
MFLFPQSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVV
GKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGG
VSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVML
WLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGK
TKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN
Download sequence
Identical sequences A0A2I0M396
XP_005015039.2.99704 XP_013043306.1.65836 XP_013224281.1.63277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]