SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I1D6H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I1D6H1
Domain Number 1 Region: 55-106
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.97e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00058
Further Details:      
 
Domain Number 2 Region: 7-57
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 5.23e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I1D6H1
Sequence length 111
Comment (tr|A0A2I1D6H1|A0A2I1D6H1_9EURO) Transcription initiation factor IIA subunit 2 {ECO:0000256|PIRNR:PIRNR009415} OX=1392248 OS=Aspergillus campestris IBT 28561. GN=P168DRAFT_288941 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSAQSYYELYRGSSLGLSLTDTLDDLINEGRIEPQLAMKILSTFDRIITEVLADKVRARL
NFKGHLDTYRFCDEVWTFLIKDVTFKLDNQTPVTADKVKIVSCNSKRPGEV
Download sequence
Identical sequences A0A2I1D6H1 A0A2J5HXC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]