SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I2ENC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2ENC8
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.63e-86
Family Capz beta-1 subunit 0.000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2ENC8
Sequence length 266
Comment (tr|A0A2I2ENC8|A0A2I2ENC8_9EURO) F-actin capping protein, beta subunit {ECO:0000313|EMBL:PLB29840.1} OX=1392256 OS=Aspergillus ochraceoroseus IBT 24754. GN=P175DRAFT_374468 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MADAQFDSALDLLRRLNPRDTKQNLQAITSIVPDLTEDLLSSVDQPLEIRKCPKTDRDYL
LCDYNRDGDSYRSPWSNEFDPPLEDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVILLKKGVTPGAKSSGEWDSIHVFEATDRARMSHYKLTSTVILHLANESE
SLGEMDLSGNMTRQVEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGE
LRSLPSLSESNRDRATHLEMIRSMHS
Download sequence
Identical sequences A0A100I2X7 A0A1L9NCE4 A0A2I2ENC8
jgi|Asptu1|116753|e_gw1.2.1170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]