SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2UD43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UD43
Domain Number 1 Region: 5-40
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000628
Family Transducin (heterotrimeric G protein), gamma chain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UD43
Sequence length 63
Comment (tr|A0A2I2UD43|A0A2I2UD43_FELCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSFCAP00000030394} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN= OC=Felinae; Felis.
Sequence
MSFRASVNVLQCLMEQLKLDASVESIKASQAPAELQQYCTMPCWLGVPAESNTFWELRSC
ALF
Download sequence
Identical sequences A0A2I2UD43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]