SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I2UP34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UP34
Domain Number 1 Region: 8-37
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000000445
Family Capz alpha-1 subunit 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UP34
Sequence length 88
Comment (tr|A0A2I2UP34|A0A2I2UP34_FELCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSFCAP00000034093} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN= OC=Felinae; Felis.
Sequence
MPNFEDWVSDEEKVRIAAKFITHAPPGEFNEVFNNLNGRHVYPSPSDCFDHHLLHLINVV
FKSLDWAFQILFWGQYLSLVTCYLRECY
Download sequence
Identical sequences A0A2I2UP34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]