SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3CDR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I3CDR1
Domain Number - Region: 117-252
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0942
Family Capz alpha-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3CDR1
Sequence length 311
Comment (tr|A0A2I3CDR1|A0A2I3CDR1_VIBAX) Putative lipopolysaccharide A protein {ECO:0000313|EMBL:AGV18191.1} KW=Complete proteome OX=1219076 OS=NCIMB 1903 / XII-53). GN=N646_2379 OC=Vibrionaceae; Vibrio.
Sequence
MKDSKFPYYFSNALSILIPRFVYRAQAKRLLSNLTEAELQRCLERVNYYNKCETPFSVDS
REQSYSTIDTFKKTKGWTYFFDLRQVVRYFPSSFAFNYINGDVTHIPNVPSFIKSRPIFG
NNQNSVVLKLNQVRHFKFIDDPVRYQDKKDMVAWRGVGFQPHRKKVIHAFYNHPQCNIGQ
TRPVEGKPWEKGFMSIEEQLQYKFLLCIEGNDVATNLKWAMSSNSLVIMSKPKYETWFME
GKLEAGVHYVEVKDDYSDLPEKMDYYLANEQEALAIIENAHQWVEQFKDKRKERLISLMV
ADKYFALSQQQ
Download sequence
Identical sequences A0A0P7F6Z5 A0A2I3CDR1
WP_017820710.1.11784 WP_017820710.1.15699 WP_017820710.1.18388 WP_017820710.1.58614 WP_017820710.1.77537 WP_017820710.1.88573 gi|543944272|ref|YP_008536728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]