SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3LL72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3LL72
Domain Number 1 Region: 52-91
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000131
Family Transducin (heterotrimeric G protein), gamma chain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3LL72
Sequence length 94
Comment (tr|A0A2I3LL72|A0A2I3LL72_PAPAN) G protein subunit gamma 14 {ECO:0000313|Ensembl:ENSPANP00000024250} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=GNG14 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSSKVTISGDTGQACQAVEQLRMKVGIDRVKVRVGASAEYMPVSDLTDPLGLQVSKVAAD
LLQFCTEQAKSNPFLVGIPATMNPFKEKKPCAIL
Download sequence
Identical sequences A0A2I3LL72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]