SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I7YZV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I7YZV8
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily EF2458-like 8.37e-36
Family EF2458-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I7YZV8
Sequence length 93
Comment (tr|A0A2I7YZV8|A0A2I7YZV8_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AUS85588.1} OX=2072025 OS=Lysinibacillus sp. YS11. GN=LBYS11_04230 OC=Lysinibacillus.
Sequence
MDTKSQTSFQEKALELLVADADKIARLIRVQMDHLTMPQCPLYEEVLDTQMFGLSREIDF
AVKLGLIEREKGKEILDSLEKELSVLHDAYTDK
Download sequence
Identical sequences A0A0A3INE1 A0A0B1Y6C6 A0A0J6NHN9 A0A0M8PV63 A0A0N0CW76 A0A0P7N6P1 A0A1E4R3S3 A0A1H8D7P6 A0A2I7YZV8 A3I4L9 D7WMF5 R7ZGG6
WP_004224778.1.16552 WP_004224778.1.17750 WP_004224778.1.17946 WP_004224778.1.18137 WP_004224778.1.24768 WP_004224778.1.29065 WP_004224778.1.30813 WP_004224778.1.36173 WP_004224778.1.42526 WP_004224778.1.48708 WP_004224778.1.48789 WP_004224778.1.56036 WP_004224778.1.5771 WP_004224778.1.58816 WP_004224778.1.69952 WP_004224778.1.70198 WP_004224778.1.72481 WP_004224778.1.74654 WP_004224778.1.75025 WP_004224778.1.75943 WP_004224778.1.77155 WP_004224778.1.8573 WP_004224778.1.88078 WP_004224778.1.91122 WP_004224778.1.93799 WP_004224778.1.96861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]