SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I8C269 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I8C269
Domain Number - Region: 2-41
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0183
Family Occludin/ELL domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I8C269
Sequence length 74
Comment (tr|A0A2I8C269|A0A2I8C269_9ESCH) DUF465 domain-containing protein {ECO:0000313|EMBL:AUT26590.1} OX=1499973 OS=Escherichia marmotae. GN=C1192_05255 OC=Enterobacteriaceae; Escherichia.
Sequence
MFPEYRDLISRLKNENPRFMSLFDKHNKLDHEIARKEGSDGRGYNAEVVRMKKQKLQLKD
EMLKILQQESVKEM
Download sequence
Identical sequences A0A1X3M8V0 A0A2B7LNA9 A0A2I8C269 I6BR07 L2VWY9 S1CSB7 S1FAK5 S1LKK9
WP_001516426.1.101935 WP_001516426.1.11948 WP_001516426.1.13979 WP_001516426.1.35985 WP_001516426.1.36786 WP_001516426.1.49376 WP_001516426.1.52804 WP_001516426.1.81739 WP_001516426.1.8985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]