SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J0U5W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J0U5W2
Domain Number - Region: 126-162
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 0.000118
Family DNA polymerase III psi subunit 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J0U5W2
Sequence length 169
Comment (tr|A0A2J0U5W2|A0A2J0U5W2_STEMA) Uncharacterized protein {ECO:0000313|EMBL:PJL24363.1} KW=Complete proteome OX=40324 OS=maltophilia). GN=B9Y71_02715 OC=Stenotrophomonas maltophilia group.
Sequence
MSQELPVLWSPAQQAWLQAMGYTVYHDGQLAAELDAALQLSVAEADAAAAPAVEQVRAPI
APAREPPVEAKPGSRQERPVPPRRETPVSAPDTAPAAGRPLPGGNARQPVVRLPDRLQIA
LLRASGCNPNDPATQALMDSWPLDQLRQDPAAKRALWPQLRALRKRGAP
Download sequence
Identical sequences A0A2J0U5W2 B2FMR9
522373.Smlt0670 gi|190572721|ref|YP_001970566.1| WP_012479099.1.51731 WP_012479099.1.7336 WP_012479099.1.98612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]