SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J4L6F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J4L6F9
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily YcfC-like 1.44e-47
Family YcfC-like 0.000000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J4L6F9
Sequence length 133
Comment (tr|A0A2J4L6F9|A0A2J4L6F9_KLEPN) High frequency lysogenization protein HflD {ECO:0000313|EMBL:PLK71500.1} OX=573 OS=Klebsiella pneumoniae. GN=CWN70_32470 OC=Enterobacteriaceae; Klebsiella.
Sequence
YTLSLMVLERKLAASKGAMDTLGNRIAGLHRQLEHFDLQSETLLSAMAGIYVDVISPLGP
RIQVTGSPAVLQSPQVQAKVRSALLAGIRAAVLWHQVGGGRLQLMFSRNRLVNQAKQILA
HLTPEFDLWNYPH
Download sequence
Identical sequences A0A2J4L6F9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]