SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J5A9V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J5A9V3
Domain Number 1 Region: 27-136
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 9.29e-35
Family DNA polymerase III psi subunit 0.00000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J5A9V3
Sequence length 137
Comment (tr|A0A2J5A9V3|A0A2J5A9V3_KLEPN) DNA polymerase III subunit psi {ECO:0000313|EMBL:PLM71985.1} OX=573 OS=Klebsiella pneumoniae. GN=CWN23_13330 OC=Enterobacteriaceae; Klebsiella.
Sequence
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAEIPPSLTEPLIGDILRA
LAVTPDQVLQLTPERVAMLPQDSRCNSWRLGTEASLPLAGAQVSTPAFDELQTSAPARRA
LWQQICAHEHDFYPQHG
Download sequence
Identical sequences A0A2J5A9V3
WP_048990255.1.95898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]