SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J5F1U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J5F1U1
Domain Number 1 Region: 27-102
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 9.29e-20
Family DNA polymerase III psi subunit 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J5F1U1
Sequence length 103
Comment (tr|A0A2J5F1U1|A0A2J5F1U1_KLEPN) DNA polymerase III subunit psi {ECO:0000313|EMBL:PLN43355.1} OX=573 OS=Klebsiella pneumoniae. GN=CWN75_31210 OC=Enterobacteriaceae; Klebsiella.
Sequence
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAETPPSLTEPLIGDILRA
LAVTPDQVLQLTPERVAMLPQDSRCNSWRLGTEASLPLAGAQV
Download sequence
Identical sequences A0A2J5F1U1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]