SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6JNV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6JNV5
Domain Number 1 Region: 110-172
Classification Level Classification E-value
Superfamily ssDNA-binding transcriptional regulator domain 6.12e-20
Family Transcriptional coactivator PC4 C-terminal domain 0.0009
Further Details:      
 
Domain Number 2 Region: 7-60
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000562
Family DEK C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J6JNV5
Sequence length 178
Comment (tr|A0A2J6JNV5|A0A2J6JNV5_LACSA) Uncharacterized protein {ECO:0000313|EMBL:PLY64492.1} KW=Complete proteome OX=4236 OS=Lactuca sativa (Garden lettuce). GN=LSAT_3X11280 OC=Cichorioideae; Cichorieae; Lactucinae; Lactuca.
Sequence
MDPEMAKKIEETVLEVLKDSDMDSTTEFQVRKAASEKLGVDLSVSERKKLVRNVVQTYLE
EQQAKAEAGDKAVEADEPEEVEEEEEDSEDEKKKRKKGDKEYDEEGDLIFCRLSDKRRVT
LTEFKGKHLVSIREYYKKDGKELPSSKGISLTAEQWSTFSKNVPAIEKAINKMEARLN
Download sequence
Identical sequences A0A2J6JNV5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]