SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J6PXQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6PXQ3
Domain Number 1 Region: 6-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-84
Family Capz alpha-1 subunit 0.00000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J6PXQ3
Sequence length 273
Comment (tr|A0A2J6PXQ3|A0A2J6PXQ3_9HELO) Subunits of heterodimeric actin filament capping protein Capz {ECO:0000313|EMBL:PMD18808.1} OX=1745343 OS=Pezoloma ericae. GN=NA56DRAFT_647687 OC=Helotiales; Leotiaceae; Pezoloma.
Sequence
MPSQLATVSAFVEGAPPGELADVIADIKALTIESPALVSQLGPAFEKYNEEQFATVKLPG
SSQFVIVSSHNSLGNGRYFDVESSSSFIFDHATQKASGVQSYVLESNHSDLVNSILKSLA
THVKEHYPNASYGVYPIEDDSKIAILVVANKYSPNNFWNGRWRSLYIYSPSPSSLSGSMK
VDVHYYEDGNVRLLTTKPVMASISSGSASTIVREIAGAEKKYQEELNKGFNNLSEGAFKG
LRRQLPITRQKIEWDKIAGYRLGQDIGGGSSKR
Download sequence
Identical sequences A0A2J6PXQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]