SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8GVH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8GVH8
Domain Number 1 Region: 32-133
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 1.83e-26
Family DNA polymerase III psi subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8GVH8
Sequence length 134
Comment (tr|A0A2J8GVH8|A0A2J8GVH8_VIBDI) DNA polymerase III subunit psi {ECO:0000313|EMBL:PNH90033.1} OX=685 OS=Vibrio diazotrophicus. GN=C1M56_04885 OC=Vibrionaceae; Vibrio.
Sequence
MPNQEQQYLQAMGIQSWELVHPERLQGYQASKVGLDKECKLLLVSESYPTPSEVTLFERV
LKSFNVELEQAQHVHLHNLASLDLSSLEWIWFAGCNDASISGIKKLHTPPLSEVDGNTQH
RRDLWQQICSYEAN
Download sequence
Identical sequences A0A2J8GVH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]