SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8JVE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8JVE5
Domain Number 1 Region: 13-154
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 3.53e-51
Family Troponin I 0.00000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8JVE5
Sequence length 182
Comment (tr|A0A2J8JVE5|A0A2J8JVE5_PANTR) TNNI2 isoform 5 {ECO:0000313|EMBL:PNI26694.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0044097 OC=Catarrhini; Hominidae; Pan.
Sequence
MGDLQKRNRAITARRQHLKSVMLQIAATEQEKEKSRREAEKQNYLSEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRGVGDWRKNIEEKSGMEGRKKMFES
ES
Download sequence
Identical sequences A0A2J8JVE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]