SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8NB23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8NB23
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily PTPA-like 1.57e-50
Family PTPA-like 0.000000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8NB23
Sequence length 217
Comment (tr|A0A2J8NB23|A0A2J8NB23_PANTR) PTPA isoform 20 {ECO:0000313|EMBL:PNI68953.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0012216 OC=Catarrhini; Hominidae; Pan.
Sequence
KTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLEC
ILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAEVSGGWPVCPSLLPHLVLG
WGQSKRCGAWGSCFLLPHCSALNLRPAPLTLGASESPIWGMGSQRSTSHPSPEKLQPSSV
LMSLEAEARTCCMGSWGDGGLPSPLSSGRRLLKARAV
Download sequence
Identical sequences A0A2J8NB23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]