SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8Q233 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8Q233
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 5.36e-34
Family Bcl-2 inhibitors of programmed cell death 0.00000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8Q233
Sequence length 137
Comment (tr|A0A2J8Q233|A0A2J8Q233_PANTR) BID isoform 10 {ECO:0000313|EMBL:PNI90325.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0046037 OC=Catarrhini; Hominidae; Pan.
Sequence
MDCEVNNGSGLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEAGASDNNTASAEEETEAAGSVAVERGLHGAATVILKVKKTSSGILPG
TSPRSGTAWTVASLRAW
Download sequence
Identical sequences A0A2I2ZUR1 A0A2J8Q233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]