SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8RY44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8RY44
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.07e-21
Family Ubiquitin-related 0.0000166
Further Details:      
 
Domain Number 2 Region: 228-272
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0000000000000569
Family XPC-binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 152-203
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000171
Family UBA domain 0.00024
Further Details:      
 
Domain Number 4 Region: 256-307
Classification Level Classification E-value
Superfamily UBA-like 0.000000000859
Family UBA domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8RY44
Sequence length 308
Comment (tr|A0A2J8RY44|A0A2J8RY44_PONAB) RAD23A isoform 5 {ECO:0000313|EMBL:PNJ13420.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0047841 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFLPAPTSGMSHPPPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQLKALGFPESLVIQAYFACEKNENLAANFL
LSQNFDDE
Download sequence
Identical sequences A0A2J8RY44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]