SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8T2D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8T2D2
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.19e-93
Family Capz beta-1 subunit 0.000000000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8T2D2
Sequence length 260
Comment (tr|A0A2J8T2D2|A0A2J8T2D2_PONAB) CAPZB isoform 2 {ECO:0000313|EMBL:PNJ27185.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0038225 OC=Catarrhini; Hominidae; Pongo.
Sequence
MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYR
SPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVI
LIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGS
LTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADK
SKQEALKNDLVEALKRKQQC
Download sequence
Identical sequences A0A2J8KEQ0 A0A2J8T2D2 A2AMW0 B1AK87
ENSP00000364286 ENSP00000364286 ENSMUSP00000038011 XP_011355800.1.92234 XP_013219632.1.77405 XP_015341094.1.40921 XP_015854837.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]