SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8T9I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8T9I9
Domain Number 1 Region: 127-225
Classification Level Classification E-value
Superfamily LCCL domain 6.15e-30
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily PR-1-like 7.85e-19
Family PR-1-like 0.001
Further Details:      
 
Domain Number 3 Region: 229-278
Classification Level Classification E-value
Superfamily LCCL domain 0.00000458
Family LCCL domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8T9I9
Sequence length 278
Comment (tr|A0A2J8T9I9|A0A2J8T9I9_PONAB) CRISPLD2 isoform 5 {ECO:0000313|EMBL:PNJ29707.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0036801 OC=Catarrhini; Hominidae; Pongo.
Sequence
MCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRP
CSECPPSYGGGCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKK
TSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIH
YGILDDKGGLVDITRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQ
LCPFEKPATHCPRVHCPAHCKDEPSYWAPVFGTNIYAD
Download sequence
Identical sequences A0A2J8T9I9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]