SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8UPG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8UPG1
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.12e-47
Family Capz alpha-1 subunit 0.00000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8UPG1
Sequence length 146
Comment (tr|A0A2J8UPG1|A0A2J8UPG1_PONAB) CAPZA2 isoform 9 {ECO:0000313|EMBL:PNJ47158.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0026318 OC=Catarrhini; Hominidae; Pongo.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESW
RTSVETALRAYVKEHYPNGVCTVSHQ
Download sequence
Identical sequences A0A2J8QXG3 A0A2J8UPG1 C9JUG7
ENSP00000419484 ENSP00000419484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]