SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J9UE30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J9UE30
Domain Number - Region: 27-86
Classification Level Classification E-value
Superfamily IpaD-like 0.0471
Family IpaD-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J9UE30
Sequence length 145
Comment (tr|A0A2J9UE30|A0A2J9UE30_VIBAB) Uncharacterized protein {ECO:0000313|EMBL:PNM49779.1} OX=140100 OS=Vibrio albensis. GN=AL535_009805 OC=Vibrionaceae; Vibrio.
Sequence
MPWIYAIAGLLVGIAVGMLIARLTTPQYKTQKNLQKELESAKFTIEQQRQELSDHFAQTA
EMLDTLGKDYTKLYQHMAKTATDLIPNLPEQDNPFSKLAQQKEESKQPEELEQPPKDYAL
GATGLLRGEEKAIIRSADLLNAKAS
Download sequence
Identical sequences A0A1X1LED5 A0A2J9UE30 C2HUE2
WP_001145861.1.10313 WP_001145861.1.16057 WP_001145861.1.36417 WP_001145861.1.40862 WP_001145861.1.69943 WP_001145861.1.71300 WP_001145861.1.7460 WP_001145861.1.76271 WP_001145861.1.81872 WP_001145861.1.97405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]