SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J9Y202 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J9Y202
Domain Number - Region: 60-162
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0152
Family Capz beta-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J9Y202
Sequence length 254
Comment (tr|A0A2J9Y202|A0A2J9Y202_VIBVL) DNA repair protein {ECO:0000313|EMBL:PNM94537.1} OX=672 OS=Vibrio vulnificus. GN=AL547_008740 OC=Vibrionaceae; Vibrio.
Sequence
MNIGLIIALVAVLLVLVIGYNVMLQYKVKAETAKRQESARYVAVIDATEELIGHAHHIPY
SKDLLVCLNNRILDALENMAALDPKSKQLAQRVEAMKQQIEHLKNNYQGGESTAFKVPNS
DKQAIVMLKLVKRLRDTIRNEHNKGRFDTQAYVEENARLETMQIRINIENVIKRAHDSIA
RGQAGTAVQLLRKGIDVLSTKNDAYSIQAKEKLETMLNEVDKKRSDKNAVELQQMEEKER
NNDMDALFGDKKKW
Download sequence
Identical sequences A0A2J9Y202
gi|320156742|ref|YP_004189121.1| WP_013572040.1.25536 WP_013572040.1.55006 WP_013572040.1.73066 WP_013572040.1.90288 WP_013572040.1.9921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]