SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K2UVL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K2UVL0
Domain Number - Region: 31-55
Classification Level Classification E-value
Superfamily LEM domain 0.0569
Family LEM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K2UVL0
Sequence length 63
Comment (tr|A0A2K2UVL0|A0A2K2UVL0_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:PNV74361.1} OX=293084 OS=Leptospira inadai serovar Lyme. GN=BES34_014350 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MANDPVSSDNGKQTPKAQTADEFLLQKEIQSGQPITPRIRELFYKRLKLKKTNEEAWKSI
YGD
Download sequence
Identical sequences A0A2K2UVL0 S5VTQ4 S5W9Y5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]