SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K2WQN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K2WQN4
Domain Number - Region: 22-57
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0497
Family Rabaptin-5 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K2WQN4
Sequence length 95
Comment (tr|A0A2K2WQN4|A0A2K2WQN4_9PSED) Uncharacterized protein {ECO:0000313|EMBL:PNV97115.1} OX=380021 OS=Pseudomonas protegens. GN=C1633_17245 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKTLLLLLSLILLMVLNLGYYTELEEAETHTRWFIKTSPTLRLEFFNIHANDGDYRRVEK
LTDEQRQMIIDYCKYRLGIDTQVTTQADVERCAKL
Download sequence
Identical sequences A0A1K1XBK9 A0A2C9EHX3 A0A2K2WQN4
gi|501678925|ref|YP_007998751.1| WP_015634499.1.100210 WP_015634499.1.101844 WP_015634499.1.11424 WP_015634499.1.12653 WP_015634499.1.14038 WP_015634499.1.1721 WP_015634499.1.18072 WP_015634499.1.21308 WP_015634499.1.23266 WP_015634499.1.27351 WP_015634499.1.38500 WP_015634499.1.39301 WP_015634499.1.41899 WP_015634499.1.42452 WP_015634499.1.42693 WP_015634499.1.462 WP_015634499.1.46426 WP_015634499.1.49818 WP_015634499.1.58641 WP_015634499.1.62026 WP_015634499.1.6225 WP_015634499.1.64508 WP_015634499.1.6649 WP_015634499.1.67749 WP_015634499.1.76749 WP_015634499.1.76969 WP_015634499.1.79484 WP_015634499.1.81001 WP_015634499.1.81277 WP_015634499.1.83211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]