SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K3MWB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3MWB9
Domain Number 1 Region: 4-199
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.97e-58
Family Capz beta-1 subunit 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K3MWB9
Sequence length 200
Comment (tr|A0A2K3MWB9|A0A2K3MWB9_TRIPR) Putative F-actin-capping protein subunit beta-like {ECO:0000313|EMBL:PNX95101.1} OX=57577 OS=Trifolium pratense (Red clover). GN=L195_g018284 OC=Trifolieae; Trifolium.
Sequence
MKEMEAAMGLMRRIPPKHTETALSALLSLMPNHSSDLLSQVDQPLQVLCDVDCGKEFILC
EYNRDADSYRSPWSNKYHPPLEDGSVPSSKMRKLESEANEIFAIYRDQYYEGGSSSVYMW
EDENEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEENTSYRLTSTVMLT
LTTNNEASGTFSLSGSIRRQ
Download sequence
Identical sequences A0A2K3MWB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]