SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3VMM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K3VMM9
Domain Number - Region: 37-95
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0051
Family Apolipoprotein 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K3VMM9
Sequence length 141
Comment (tr|A0A2K3VMM9|A0A2K3VMM9_STACP) YtxH domain-containing protein {ECO:0000313|EMBL:PNY90051.1} OX=74703 OS=Staphylococcus capitis subsp. urealyticus. GN=CD156_01425 OC=Staphylococcus.
Sequence
MGKSTNLFRIALGIGGAVAAVALSRKDSRDKLKNEYNKYKENPESYKANAKDFASQIGNK
ANETIQEVRNNPRDYVDRIKNDPKAFFEEEKSKFTDLDDKKADDLEEGKFDDEGGATTSN
NLRVVSEDDLKNNKNALEDKE
Download sequence
Identical sequences A0A0S4ME41 A0A1J4E4L0 A0A2K3VMM9 A0A2K4CN91
WP_002434662.1.100131 WP_002434662.1.10128 WP_002434662.1.10686 WP_002434662.1.13397 WP_002434662.1.17364 WP_002434662.1.19203 WP_002434662.1.20118 WP_002434662.1.24363 WP_002434662.1.26327 WP_002434662.1.3257 WP_002434662.1.32743 WP_002434662.1.3312 WP_002434662.1.34513 WP_002434662.1.41313 WP_002434662.1.4802 WP_002434662.1.5010 WP_002434662.1.50343 WP_002434662.1.51158 WP_002434662.1.51192 WP_002434662.1.5176 WP_002434662.1.52943 WP_002434662.1.5648 WP_002434662.1.64115 WP_002434662.1.65575 WP_002434662.1.6659 WP_002434662.1.70211 WP_002434662.1.72229 WP_002434662.1.75004 WP_002434662.1.75622 WP_002434662.1.77869 WP_002434662.1.78754 WP_002434662.1.87197 WP_002434662.1.88190 WP_002434662.1.89682 WP_002434662.1.91824 WP_002434662.1.92191 WP_002434662.1.94950 WP_002434662.1.99845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]