SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5E9C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5E9C3
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-115
Family Capz alpha-1 subunit 0.000000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5E9C3
Sequence length 273
Comment (tr|A0A2K5E9C3|A0A2K5E9C3_AOTNA) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSANAP00000029807} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN=CAPZA1 OC=Platyrrhini; Aotidae; Aotus.
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQ
VLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGGLKSWRESCDSALRAYVK
DHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLK
IQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDT
TFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A2K5E9C3 A0A2K6BXD6
ENSMMUP00000020564 ENSMMUP00000020564 9544.ENSMMUP00000020564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]