SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5HY92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5HY92
Domain Number 1 Region: 26-111
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.97e-23
Family Interleukin 8-like chemokines 0.00000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5HY92
Sequence length 114
Comment (tr|A0A2K5HY92|A0A2K5HY92_COLAP) Uncharacterized protein {ECO:0000313|Ensembl:ENSCANP00000009340} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MRLLILALLGICCLTAYIVEGVGSEVSDKSTCVSLTTQRLPVNRIKTYTIKEGSLKAVIF
ITKRGLKVCADPQARWVKDVVKSVDRKSNTRNNMNQTKPTGTQQSTNTAVTLTG
Download sequence
Identical sequences A0A2K5HY92
XP_011788808.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]