SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5J6D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5J6D5
Domain Number 1 Region: 13-161
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 3.27e-51
Family Troponin I 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5J6D5
Sequence length 182
Comment (tr|A0A2K5J6D5|A0A2K5J6D5_COLAP) Synaptotagmin 8 {ECO:0000313|Ensembl:ENSCANP00000024400} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=SYT8 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MGDEEKRNRAITARRQHLKSVMLQIAATELEKDKSRREAEKQNYLAEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEVKVQKSSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFET
ES
Download sequence
Identical sequences A0A2K5J6D5 A0A2K6M5F7 A0A2K6NUV6
XP_010380335.1.97406 XP_010380336.1.97406 XP_011785447.1.43180 XP_011785448.1.43180 XP_017730189.1.44346 XP_017730190.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]