SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5KZH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5KZH0
Domain Number 1 Region: 9-85
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 7.59e-25
Family Troponin I 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5KZH0
Sequence length 105
Comment (tr|A0A2K5KZH0|A0A2K5KZH0_CERAT) Troponin I1, slow skeletal type {ECO:0000313|Ensembl:ENSCATP00000006100} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=TNNI1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAMSGMEGRKKMFDAAKSPTSQ
Download sequence
Identical sequences A0A1D5Q7I3 A0A2I2Y7Y4 A0A2I3H7U5 A0A2I3M7W2 A0A2I3RZE4 A0A2J8UXL3 A0A2K5E9E0 A0A2K5JY77 A0A2K5KZH0 A0A2K5Q7S8 A0A2K5U490 A0A2K5Y658 A0A2K6DMK2 A0A2K6KEG4 A0A2K6PUF8 A0A2K6TAT6 G3V3L5
ENSP00000451307 ENSP00000451307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]