SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MWF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5MWF1
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.14e-21
Family Transducin (heterotrimeric G protein), gamma chain 0.0000891
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MWF1
Sequence length 75
Comment (tr|A0A2K5MWF1|A0A2K5MWF1_CERAT) G protein subunit gamma 4 {ECO:0000313|Ensembl:ENSCATP00000029559} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=GNG4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
IKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL
Download sequence
Identical sequences A0A096NXU3 A0A0D9RCF3 A0A2K5I011 A0A2K5MWF1 A0A2K5U1E9 A0A2K5ZTM4 A0A2K6E750 A0A2K6L4P5 A0A2K6QV19 F6TFY2 G1QRN5
ENSNLEP00000003603 ENSPANP00000017898 ENSMMUP00000001156 9544.ENSMMUP00000001156 ENSMMUP00000001156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]