SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5P8J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5P8J2
Domain Number 1 Region: 27-92
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.31e-24
Family Interleukin 8-like chemokines 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5P8J2
Sequence length 94
Comment (tr|A0A2K5P8J2|A0A2K5P8J2_CERAT) C-C motif chemokine ligand 26 {ECO:0000313|Ensembl:ENSCATP00000046018} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=CCL26 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MMGLSVASAVILASLLSLHLGTATRGTDIAKTCCFQHSHKSLPWTRVQSYEFTSSSCSQQ
AVIFTTKRGKKVCTNPKKKWVQRYISLLETQKQL
Download sequence
Identical sequences A0A2K5P8J2 A0A2K5YBY0
XP_011831708.1.47321 XP_011931848.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]