SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5P9M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5P9M3
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.75e-82
Family Capz alpha-1 subunit 0.0000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5P9M3
Sequence length 299
Comment (tr|A0A2K5P9M3|A0A2K5P9M3_CEBCA) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSCCAP00000000333} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=CAPZA3 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MALSVLSRKDKERVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLSIDGNPVLLSHHNVMGDFRFFDYQSKLSFKYDLLQNQLKDIQSHGIIRNETEYLRVV
VLCALKLYVNDHYPKGNCNVLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKWIFQVNP
FLTQVTGRIYVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAV
LEELQELSNEALRRILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences A0A2K5P9M3
XP_017384399.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]