SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5QW65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5QW65
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000889
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 
Domain Number 2 Region: 173-224
Classification Level Classification E-value
Superfamily Polo-box domain 0.000000000000275
Family Polo-box duplicated region 0.0032
Further Details:      
 
Domain Number 3 Region: 251-335
Classification Level Classification E-value
Superfamily Polo-box domain 0.00000000000314
Family Polo-box duplicated region 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5QW65
Sequence length 336
Comment (tr|A0A2K5QW65|A0A2K5QW65_CEBCA) Polo like kinase 5 {ECO:0000313|Ensembl:ENSCCAP00000020122} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=PLK5 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MYTVLTGTPPFTASPLSEMYQNIREGRYPEPAHLSPGARRLIARLLAPNPAERPSLDHLL
QDDFFTQGFTPDRLPAHSCHSPPIFTAPPPLGRIFRKVGQLLLTQCRPPCPFTPKEASGP
GEDGPNPDSMEWGSESSLTAKGVPCLEAPIHLIAQGTLQSDLAGPEGSRQPEVEAALRHL
QLCVDAGPPATQDPLGEQQPILWASKWVDYSSKYGFGYQLSDGGSAGWHSYGPASPRREG
TLPTPVPPAGPGLCLLRFLASEQALLLLLSNGTVQMSFSGVPAQLLLSGEGEGLQLTLWE
QGPPGTSSSLDVLRNHGCTPATRQRLHHALRMLQSI
Download sequence
Identical sequences A0A2K5QW65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]