SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5RAE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5RAE6
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.11e-114
Family Capz alpha-1 subunit 0.000000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5RAE6
Sequence length 286
Comment (tr|A0A2K5RAE6|A0A2K5RAE6_CEBCA) Capping actin protein of muscle Z-line alpha subunit 2 {ECO:0000313|Ensembl:ENSCCAP00000025103} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=CAPZA2 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAIESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A2K5RAE6 Q07DV7 Q09YH6 Q09YL0 Q2QLG4 U3DUR6
ENSCJAP00000009374 ENSCJAP00000009356 XP_002751816.1.60252 XP_017390550.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]