SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5RUR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5RUR2
Domain Number 1 Region: 11-192
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 1.05e-53
Family Bcl-2 inhibitors of programmed cell death 0.0000000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5RUR2
Sequence length 204
Comment (tr|A0A2K5RUR2|A0A2K5RUR2_CEBCA) BCL2L2-PABPN1 readthrough {ECO:0000313|Ensembl:ENSCCAP00000031836} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=BCL2L2-PABPN1 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAE
SVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWAS
VRTVLTGAVALGALVTVGAFFASK
Download sequence
Identical sequences A0A2K5CWY6 A0A2K5RUR2 A0A2K6TMF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]