SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5S6K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5S6K7
Domain Number 1 Region: 28-90
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 2.36e-26
Family Interleukin 8-like chemokines 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5S6K7
Sequence length 93
Comment (tr|A0A2K5S6K7|A0A2K5S6K7_CEBCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCCAP00000036015} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN= OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MKVSAAALAILLCTMALCSQVFSAPPGADTPTACCFRYISRKIPQNFIADYFETSSQCSK
PGIIFLTKKGRQVCADPSQEWVQKYVSDLELNA
Download sequence
Identical sequences A0A2K5S6K7
XP_017395390.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]