SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5SIL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5SIL2
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 7.66e-17
Family Bcl-2 inhibitors of programmed cell death 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5SIL2
Sequence length 163
Comment (tr|A0A2K5SIL2|A0A2K5SIL2_CEBCA) BCL2 like 15 {ECO:0000313|Ensembl:ENSCCAP00000040215} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=BCL2L15 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MKSPQTFEEQTECIVNTLLMDFLSPTLQVANRDLGCEDEVDSGESCSFDVEIIAGRLRML
GDQFNGELEASAKSVLAETIQGQAGAMLQSTVESLSRTWCGSDSSLVYERAFLAVSVKLL
ECVAHMAPEVVRQVANSMMGMINGNRAIREFIQGQGGWENLER
Download sequence
Identical sequences A0A2K5SIL2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]