SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5UBH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UBH4
Domain Number 1 Region: 12-276
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-114
Family Capz alpha-1 subunit 0.00000000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UBH4
Sequence length 281
Comment (tr|A0A2K5UBH4|A0A2K5UBH4_MACFA) F-actin-capping protein subunit alpha-1 {ECO:0000313|Ensembl:ENSMFAP00000009715} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=CAPZA1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
RLRQEDRLSPGAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPV
KIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGGLKSWRESCD
SALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPT
AQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISE
NYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A2K5UBH4 A0A2K5Z5Q2 A0A2K6BXF7 A0A2K6JWF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]